PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g19702.1.p
Common NameBRADI_1g19702, LOC100840894
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 579aa    MW: 61756.9 Da    PI: 6.8853
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g19702.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.43.1e-13127187262
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       +e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++    e a lk +
  Bradi1g19702.1.p 127 EEAKRRARLVRNRESAHMSRQRKKQYVEELEGKVKAMQATIADLSARISCAAAENAGLKRQ 187
                       799******************************************9999888888888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.1E-11125190IPR004827Basic-leucine zipper domain
PfamPF001706.4E-12127188IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.944128191IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-12130188No hitNo description
Gene3DG3DSA:1.20.5.1705.0E-15130189No hitNo description
CDDcd147041.72E-19131182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MTGSAAHMAE PCLFADMPSF LDDLPEFPHP PDDETFALED FDLEDLDFDF DLDLFSTDDA  60
QLSTPPPPPP PLATSSSSAG SPGGGSSSSG AAVDGAGGGL KNDESSESSS RSASAVSDGK  120
PRNGEDEEAK RRARLVRNRE SAHMSRQRKK QYVEELEGKV KAMQATIADL SARISCAAAE  180
NAGLKRQLSG VAGTPAPPPL PMYPGLYPLP PPWLHPAYAM RGSQVPLVPI PRLKTRKPAP  240
AEVEPPAKKT RKTKKVASVS LLGLLFLVMV CGCLVPAVNR MYGTVDSGEG IVLAPSHHGR  300
VLAVEGPRNG APDGIDSKLP QNSSETLPAL LYLPRNGKHV KINGNLVIQS VVASEKASSR  360
MSQYDPKISG NPGKEETSLA IPGHVAKLDS GEVPKSAQGI KNKLMVLPPG DRTIYREDDE  420
LLPQWFSEAM SGPTLSSGMC TEVFQFDISP TSADANGIVP VYSSAMPNSS HNLTENLPST  480
RPQKIKNRRI LHSVPIPLQG STSNHTDRLK EHPKNESFAG NKPASSVVVS VLADPREDSE  540
GRISSKSLSR IFVVVLVDSV KYVTYSCVLP FKNHSPHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562569.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLI1GRS70.0I1GRS7_BRADI; Uncharacterized protein
STRINGBRADI1G19702.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Representative plantOGRP21711628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.13e-78bZIP family protein